PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_02385.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 321aa    MW: 36477.1 Da    PI: 6.3931
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_02385.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.73.9e-52221511129
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lppGfrFhPtdeel+++yL+ kv +  l    +i+evd++++ePw+Lp+++k +e+ewyf+s rd+ky+tg r+nrat++gyWkat
  Rsa1.0_02385.1_g00001.1  22 LPPGFRFHPTDEELITFYLASKVFHGGLCG-LHIAEVDLNRCEPWELPEMAKMGEREWYFYSLRDRKYPTGLRTNRATTAGYWKAT 106
                              79************************9877.56***************9889999******************************* PP

                      NAM  87 gkdkevlsk..kgelvglkktLvfykgrapkgektdWvmheyrle 129
                              gkdke++s   +g+lvg+kktLvfykgrap+g k++Wvmheyrle
  Rsa1.0_02385.1_g00001.1 107 GKDKEIFSGggGGALVGMKKTLVFYKGRAPRGLKSKWVMHEYRLE 151
                              ********9878889****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.97E-6219172IPR003441NAC domain
PROSITE profilePS5100557.94622172IPR003441NAC domain
PfamPF023651.5E-2623150IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MMLAVEDVLS ELAGEEKNNG GLPPGFRFHP TDEELITFYL ASKVFHGGLC GLHIAEVDLN  60
RCEPWELPEM AKMGEREWYF YSLRDRKYPT GLRTNRATTA GYWKATGKDK EIFSGGGGGA  120
LVGMKKTLVF YKGRAPRGLK SKWVMHEYRL ETDLSHRHTC KEEWVICRVL NKPGDRKNVG  180
IHNKISYLHN ASLSTTQHHH LEILPTLLEP SKTLTNFPPL PYDDTHQNYN NLFHESLGHN  240
VDELKVLINP VVSQLNGVIF SPENNYYNND ENDNFGVKTE QYSNGDNTDL DVRDYLEKPL  300
FQEAGYSLLG LSSSPGPPML Y
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-482217215168Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013674887.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 3-like
RefseqXP_013676762.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 3-like
SwissprotQ9S8511e-178NAC31_ARATH; Protein CUP-SHAPED COTYLEDON 3
TrEMBLA0A078G4Q70.0A0A078G4Q7_BRANA; BnaC02g24050D protein
STRINGBra008259.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40028174
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76420.11e-168NAC family protein